PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000259279
Common NameLOC103428900, WRKY5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 270aa    MW: 30432 Da    PI: 8.9471
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000259279genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1031.7e-32191249159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  MDP0000259279 191 LDDGYKWRKYGQKVVKNTQHPRSYYRCTMDNCRVKKRVERLAEDPRMVITTYEGRHVHS 249
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-33176249IPR003657WRKY domain
SuperFamilySSF1182901.44E-28184250IPR003657WRKY domain
PROSITE profilePS5081129.126186251IPR003657WRKY domain
SMARTSM007744.0E-37191250IPR003657WRKY domain
PfamPF031063.8E-25192248IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MASRTSQAAI LNQQQQQLGL FENQEGEGCN TQMGFFHFPP NLTFSSLPFL GHQSLKGGFS  60
TASIASDDAP STTTLSETLV PRPSLTPSPL RHKQDHNITT TSSEFGGGGG GAHAHLLSLQ  120
RSTANLWAWG DVSDDRDEYC LNSKRSSGGD DQHHPYLGGV SAMKMKKMKA IRRKVREPRF  180
CFKTLSDVDV LDDGYKWRKY GQKVVKNTQH PRSYYRCTMD NCRVKKRVER LAEDPRMVIT  240
TYEGRHVHSP SHDLEDQDSR SPSHLNNFFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-26182248874Probable WRKY transcription factor 4
1wj2_A3e-26182248874Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.302490.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008365254.10.0PREDICTED: probable WRKY transcription factor 13
SwissprotQ9SVB77e-66WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLD9ZJG00.0D9ZJG0_MALDO; WRKY domain class transcription factor
STRINGVIT_07s0031g01840.t012e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40793361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.18e-60WRKY DNA-binding protein 13